PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0402s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 308aa    MW: 33810.6 Da    PI: 8.4209
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0402s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.72.3e-3275129358
          ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                           vrY+eClkNhAas+Gg + DGCgEfmps geegt++al+CaAC+CHRnFHR+e +
  Cagra.0402s0006.1.p  75 PVRYRECLKNHAASVGGSVHDGCGEFMPS-GEEGTIEALRCAACDCHRNFHRKEID 129
                          689*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047706.4E-3076128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257745.0E-2676129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.9E-3077128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.27678127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.4E-31231300IPR009057Homeodomain-like
SuperFamilySSF466898.33E-20233300IPR009057Homeodomain-like
PROSITE profilePS500718.568237301IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-29239296IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDMRSHEMIE RRRDDNGNNG GVISNIITTN NDDNCNGNNN NNNNNTRVSC NSQTLDHHQS  60
KSPSSFSISA AVQSPVRYRE CLKNHAASVG GSVHDGCGEF MPSGEEGTIE ALRCAACDCH  120
RNFHRKEIDG VGSSDLIAHH RHHHHHHNQY GGGRRPPPNM MLNPLMLPPP PNYQPIHHHK  180
YGMSPTGGGG MVTPMSVAYG GGGGGAESSS EDLNLYGQSS GEGAGAAAGQ MAFSMSSSKK  240
RFRTKFTTEQ KERMMEFAEK LGWRMNKQDE EELKRFCGEI GVKRQVFKVW MHNNKNNAKK  300
PPTPTTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-232382981676ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0258140.0AC025814.7 Arabidopsis thaliana chromosome 1 BAC F22H5 genomic sequence, complete sequence.
GenBankAK2290380.0AK229038.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-33-K14.
GenBankAY0844620.0AY084462.1 Arabidopsis thaliana clone 10873 mRNA, complete sequence.
GenBankBT0288940.0BT028894.1 Arabidopsis thaliana unknown protein (At1g75240) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302600.11e-177hypothetical protein CARUB_v10020705mg
SwissprotQ9FRL51e-145ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLR0IFI11e-177R0IFI1_9BRAS; Uncharacterized protein
STRINGAT1G75240.11e-143(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72792543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.11e-110homeobox protein 33